PDB entry 1tyt

View 1tyt on RCSB PDB site
Description: crystal and molecular structure of crithidia fasciculata trypanothione reductase at 2.6 angstroms resolution
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1993-06-10, released 1994-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.161
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypanothione reductase, oxidized form
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tyta1, d1tyta2, d1tyta3
  • Chain 'B':
    Compound: trypanothione reductase, oxidized form
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tytb1, d1tytb2, d1tytb3
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tytA (A:)
    msraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpk
    klmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadtegl
    tfhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiegddlcitsne
    afyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgfdselrkqlte
    qlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigrvprsqtlqldkag
    vevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpratdht
    kvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtnha
    dgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfyqk
    gkrveki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tytB (B:)
    msraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpk
    klmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadtegl
    tfhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiegddlcitsne
    afyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgfdselrkqlte
    qlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigrvprsqtlqldkag
    vevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpratdht
    kvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtnha
    dgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfyqk
    gkrveki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tytB (B:)
    sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk
    lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt
    fhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiegddlcitsnea
    fyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgfdselrkqlteq
    lranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigrvprsqtlqldkagv
    evakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpratdhtk
    vacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtnhad
    gevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfyqkg
    krveki