PDB entry 1tys

View 1tys on RCSB PDB site
Description: water-mediated substrate(slash)product discrimination: the product complex of thymidylate synthase at 1.83 angstroms
Class: transferase
Keywords: transferase, methyltransferase
Deposited on 1993-05-07, released 1994-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00470 (0-263)
      • conflict (145)
    Domains in SCOPe 2.08: d1tysa_
  • Heterogens: TMP, DHF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tysA (A:)
    mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
    wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
    ndpdsrriivsawnvgeldkmalapshaffqfyvadgklscqlyqrscdvflglpfnias
    yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
    dyrfedfeiegydphpgikapvai