PDB entry 1typ

View 1typ on RCSB PDB site
Description: substrate interactions between trypanothione reductase and n1-glutathionylspermidine disulphide at 0.28-nm resolution
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1992-06-29, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.148
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypanothione reductase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39040 (0-486)
      • conflict (125)
    Domains in SCOPe 2.07: d1typa1, d1typa2, d1typa3
  • Chain 'B':
    Compound: trypanothione reductase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39040 (Start-486)
      • conflict (125)
    Domains in SCOPe 2.07: d1typb1, d1typb2, d1typb3
  • Heterogens: FAD, NAP, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1typA (A:)
    msraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpk
    klmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadtegl
    tfhqgwgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiegddlcitsne
    afyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgfdselrkqlte
    qlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigrvprsqtlqldkag
    vevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpratdht
    kvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtnha
    dgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfyqk
    gkrveki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1typB (B:)
    msraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpk
    klmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadtegl
    tfhqgwgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiegddlcitsne
    afyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgfdselrkqlte
    qlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigrvprsqtlqldkag
    vevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpratdht
    kvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtnha
    dgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfyqk
    gkrveki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1typB (B:)
    sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk
    lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt
    fhqgwgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiegddlcitsnea
    fyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgfdselrkqlteq
    lranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigrvprsqtlqldkagv
    evakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpratdhtk
    vacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtnhad
    gevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfyqkg
    krveki