PDB entry 1tyn

View 1tyn on RCSB PDB site
Description: atomic structure of the trypsin-cyclotheonamide a complex: lessons for the design of serine protease inhibitors
Class: hydrolase(serine protease)
Keywords: hydrolase(serine protease)
Deposited on 1994-09-19, released 1995-01-26
The last revision prior to the SCOP 1.75 freeze date was dated 1995-01-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-trypsin
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tyna_
  • Heterogens: CTA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tynA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn