PDB entry 1tyn

View 1tyn on RCSB PDB site
Description: atomic structure of the trypsin-cyclotheonamide a complex: lessons for the design of serine protease inhibitors
Deposited on 1994-09-19, released 1995-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1tyn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tyn_ (-)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn