PDB entry 1tyl
View 1tyl on RCSB PDB site
Description: the structure of a complex of hexameric insulin and 4'-hydroxyacetanilide
Class: hormone
Keywords: hormone
Deposited on
1994-06-21, released
1994-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1tyl.1 - Chain 'B':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1tyl.1 - Chain 'C':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1tyl.2 - Chain 'D':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1tyl.2 - Heterogens: ZN, CL, TYL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1tylA (A:)
giveqcctsicslyqlenycn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1tylB (B:)
fvnqhlcgshlvealylvcgergffytpkt
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1tylC (C:)
giveqcctsicslyqlenycn
- Chain 'D':
Sequence, based on SEQRES records: (download)
>1tylD (D:)
fvnqhlcgshlvealylvcgergffytpkt
Sequence, based on observed residues (ATOM records): (download)
>1tylD (D:)
nqhlcgshlvealylvcgergffytpkt