PDB entry 1tyl

View 1tyl on RCSB PDB site
Description: the structure of a complex of hexameric insulin and 4'-hydroxyacetanilide
Class: hormone
Keywords: hormone
Deposited on 1994-06-21, released 1994-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tyl.1
  • Chain 'B':
    Compound: insulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tyl.1
  • Chain 'C':
    Compound: insulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tyl.2
  • Chain 'D':
    Compound: insulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tyl.2
  • Heterogens: ZN, CL, TYL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tylA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tylB (B:)
    fvnqhlcgshlvealylvcgergffytpkt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tylC (C:)
    giveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tylD (D:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tylD (D:)
    nqhlcgshlvealylvcgergffytpkt