PDB entry 1tyj

View 1tyj on RCSB PDB site
Description: Crystal Structure Analysis of type II Cohesin A11 from Bacteroides cellulosolvens
Class: structural protein
Keywords: beta sandwich, dockerin-binding module, alpha helix, flaps, STRUCTURAL PROTEIN
Deposited on 2004-07-08, released 2005-04-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.17
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cellulosomal scaffoldin
  Species: Bacteroides cellulosolvens [TaxId:35825]
  Gene: CipBc(ScaA)
  Database cross-references and differences (RAF-indexed):
  • GB AAG01230 (0-169)
  Domains in SCOPe 2.01: d1tyja1
• Heterogens: EDO, MOH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tyjA (A:)
  gsvltaidndkvavgdkvtltinvdkitnfsgyqfnikynttylqpwdtiadeaytdstm
  pdygtllqgrfnatdmskhnlsqgvlnfgrlymnlsayrasgkpestgavakvtfkvike
  ipaegiklatfengssmnnavdgtmlfdwdgnmysssaykvvqpgliypk