PDB entry 1tyh

View 1tyh on RCSB PDB site
Description: Crystal Structure of Transcriptional Activator tenA from Bacillus subtilis
Class: transcription
Keywords: all helical structure, tetramer, tenA, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, transcription
Deposited on 2004-07-07, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.244
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional activator tenA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: TENA, BSU11650
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25052 (3-End)
      • cloning artifact (2)
      • modified residue (72)
      • modified residue (84)
      • modified residue (117)
      • modified residue (195)
      • modified residue (212)
    Domains in SCOPe 2.07: d1tyha1, d1tyha2
  • Chain 'B':
    Compound: Transcriptional activator tenA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: TENA, BSU11650
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25052 (3-End)
      • cloning artifact (2)
      • modified residue (72)
      • modified residue (84)
      • modified residue (117)
      • modified residue (195)
      • modified residue (212)
    Domains in SCOPe 2.07: d1tyhb1, d1tyhb2
  • Chain 'D':
    Compound: Transcriptional activator tenA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: TENA, BSU11650
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25052 (3-End)
      • cloning artifact (2)
      • modified residue (72)
      • modified residue (84)
      • modified residue (117)
      • modified residue (195)
      • modified residue (212)
    Domains in SCOPe 2.07: d1tyhd1, d1tyhd2
  • Chain 'E':
    Compound: Transcriptional activator tenA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: TENA, BSU11650
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25052 (3-End)
      • cloning artifact (2)
      • modified residue (72)
      • modified residue (84)
      • modified residue (117)
      • modified residue (195)
      • modified residue (212)
    Domains in SCOPe 2.07: d1tyhe1, d1tyhe2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tyhA (A:)
    mslkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfg
    aayakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyr
    svlsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinr
    fdelaensteevrakmkenfvissyyeyqfwgmayrkegwsdsaikeveecgasrhngeg
    gshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyhA (A:)
    lkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa
    yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsv
    lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd
    elaensteevrakmkenfvissyyeyqfwgmayrkegwsds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tyhB (B:)
    mslkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfg
    aayakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyr
    svlsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinr
    fdelaensteevrakmkenfvissyyeyqfwgmayrkegwsdsaikeveecgasrhngeg
    gshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyhB (B:)
    lkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa
    yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsv
    lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd
    elaensteevrakmkenfvissyyeyqfwgmayrkegwsds
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tyhD (D:)
    mslkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfg
    aayakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyr
    svlsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinr
    fdelaensteevrakmkenfvissyyeyqfwgmayrkegwsdsaikeveecgasrhngeg
    gshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyhD (D:)
    lkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa
    yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsv
    lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd
    elaensteevrakmkenfvissyyeyqfwgmayrkegwsds
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tyhE (E:)
    mslkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfg
    aayakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyr
    svlsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinr
    fdelaensteevrakmkenfvissyyeyqfwgmayrkegwsdsaikeveecgasrhngeg
    gshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyhE (E:)
    lkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa
    yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsv
    lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd
    elaensteevrakmkenfvissyyeyqfwgmayrkegwsds