PDB entry 1tyg

View 1tyg on RCSB PDB site
Description: Structure of the thiazole synthase/ThiS complex
Class: biosynthetic protein
Keywords: alpha beta barrel, protein-protein complex, ThiS, ThiG, BIOSYNTHETIC PROTEIN
Deposited on 2004-07-07, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.247
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiazole biosynthesis protein thiG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: thiG,BSU11690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tyga_
  • Chain 'B':
    Compound: yjbS
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tygb_
  • Chain 'C':
    Compound: Thiazole biosynthesis protein thiG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: thiG,BSU11690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tygc_
  • Chain 'G':
    Compound: yjbS
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tygg_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tygA (A:)
    mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleqld
    lskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseql
    leegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvi
    vdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplk
    qygtasspgeglp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tygA (A:)
    mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleqld
    lskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseql
    leegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvi
    vdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplk
    qy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tygB (B:)
    mghhhhhhhhhhssghiggrhmlqlngkdvkwkkdtgtiqdllasyqlenkivivernke
    iigkeryhevelcdrdvieivhfvggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tygB (B:)
    mlqlngkdvkwkkdtgtiqdllasyqlenkivivernkeiigkeryhevelcdrdvieiv
    hfvgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tygC (C:)
    mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleqld
    lskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseql
    leegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvi
    vdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplk
    qygtasspgeglp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tygC (C:)
    mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfafeasqpnfleqldlskytl
    lpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseqlleegfi
    vlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvivdagig
    spkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplkqyg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tygG (G:)
    mghhhhhhhhhhssghiggrhmlqlngkdvkwkkdtgtiqdllasyqlenkivivernke
    iigkeryhevelcdrdvieivhfvggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tygG (G:)
    mlqlngkdvkwkkdtgtiqdllasyqlenkivivernkeiigkeryhevelcdrdvieiv
    hfvg