PDB entry 1tyc

View 1tyc on RCSB PDB site
Description: structural analysis of a series of mutants of tyrosyl-tRNA synthetase: enhancement of catalysis by hydrophobic interactions
Class: aminoacyl-tRNA synthase
Keywords: aminoacyl-tRNA synthase
Deposited on 1992-07-06, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00952 (0-318)
      • conflict (50)
    Domains in SCOPe 2.07: d1tyca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tycA (A:)
    mdllaelqwrglvnqttdedglrkllneervtlycgfdptadslhighlapiltmrrfqq
    aghrpialvggatgligdpsgkksertlnaketveawsarikeqlgrfldfeadgnpaki
    knnydwigpldvitflrdvgkhfsvnymmakesvqsrietgisftefsymmlqaydflrl
    yetegcrlqiggsdqwgnitaglelirktkgearafgltiplvtkadgtkfgktesgtiw
    ldkektspyefyqfwintddrdvirylkyftflskeeiealeqelreapekraaqktlae
    evtklvhgeealrqairis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tycA (A:)
    mdllaelqwrglvnqttdedglrkllneervtlycgfdptadslhighlapiltmrrfqq
    aghrpialvggatgligdpsgkksertlnaketveawsarikeqlgrfldfeadgnpaki
    knnydwigpldvitflrdvgkhfsvnymmakesvqsrietgisftefsymmlqaydflrl
    yetegcrlqiggsdqwgnitaglelirktkgrafgltiplvtkadgtkfgktesgtiwld
    kektspyefyqfwintddrdvirylkyftflskeeiealeqelreapekraaqktlaeev
    tklvhgeealrqairis