PDB entry 1ty9

View 1ty9 on RCSB PDB site
Description: x-ray crystal structure of phzg from pseudomonas fluorescens
Class: oxidoreductase
Keywords: phenazine, phzg, chorismate, pseudomonas, oxidoreductase
Deposited on 2004-07-07, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenazine biosynthesis protein phzG
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: phzG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ty9a_
  • Chain 'B':
    Compound: Phenazine biosynthesis protein phzG
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: phzG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ty9b_
  • Heterogens: SO4, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ty9A (A:)
    mngsiqgkpllgkgmsesltgtldapfpeyqtlpadpmsvlhnwlerarrvgireprala
    latadsqgrpstrivviseisdagvvfsthagsqkgrellhnpwasgvlywretsqqiil
    ngqavrlpnakaddawlkrpyathpmssvsrqseelqdvqamrnaarqlaelqgplprpe
    gycvfelrleslefwgngqerlherlrydrsdtgwnvrrlqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ty9A (A:)
    gtldapfpeyqtlpadpmsvlhnwlerarrvgirepralalatadsqgrpstrivvisei
    sdagvvfsthagsqkgrellhnpwasgvlywretsqqiilngqavrlpnakaddawlkrp
    yathpmssvsrqseelqdvqamrnaarqlaelqgplprpegycvfelrleslefwgngqe
    rlherlrydrsdtgwnvrrlqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ty9B (B:)
    mngsiqgkpllgkgmsesltgtldapfpeyqtlpadpmsvlhnwlerarrvgireprala
    latadsqgrpstrivviseisdagvvfsthagsqkgrellhnpwasgvlywretsqqiil
    ngqavrlpnakaddawlkrpyathpmssvsrqseelqdvqamrnaarqlaelqgplprpe
    gycvfelrleslefwgngqerlherlrydrsdtgwnvrrlqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ty9B (B:)
    sesltgtldapfpeyqtlpadpmsvlhnwlerarrvgirepralalatadsqgrpstriv
    viseisdagvvfsthagsqkgrellhnpwasgvlywretsqqiilngqavrlpnakadda
    wlkrpyathpmssvsrqseelqdvqamrnaarqlaelqgplprpegycvfelrleslefw
    gngqerlherlrydrsdtgwnvrrlqp