PDB entry 1ty0

View 1ty0 on RCSB PDB site
Description: Crystal structure of the streptococcal pyrogenic exotoxin J (SPE-J)
Class: immune system
Keywords: Superantigen, T-cell receptor binding, mutagenesis, dimerization, crystal structure, immune system
Deposited on 2004-07-06, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.21
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative exotoxin (superantigen)
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: spe-j
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ty0a1, d1ty0a2
  • Chain 'B':
    Compound: putative exotoxin (superantigen)
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: spe-j
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ty0b1, d1ty0b2
  • Chain 'C':
    Compound: putative exotoxin (superantigen)
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: spe-j
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ty0c1, d1ty0c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ty0A (A:)
    ksdsenikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyi
    ttkftknqkvnifglpyiftrydvyyiyggvtpsvnsnsenskivgnllidgvqqktlin
    pikidkpiftiqefdfkirqylmqtykiydpnspyikgqleiaingnkhesfnlydatss
    strsdifkkykdnktinmkdfshfdiylwtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ty0B (B:)
    ksdsenikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyi
    ttkftknqkvnifglpyiftrydvyyiyggvtpsvnsnsenskivgnllidgvqqktlin
    pikidkpiftiqefdfkirqylmqtykiydpnspyikgqleiaingnkhesfnlydatss
    strsdifkkykdnktinmkdfshfdiylwtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ty0B (B:)
    ksdsenikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyi
    ttkftknqkvnifglpyiftrydvyyiyggvtpsvnsnkivgnllidgvqqktlinpiki
    dkpiftiqefdfkirqylmqtykiydpnspyikgqleiaingnkhesfnlydatssstrs
    difkkykdnktinmkdfshfdiylwtk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ty0C (C:)
    ksdsenikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyi
    ttkftknqkvnifglpyiftrydvyyiyggvtpsvnsnsenskivgnllidgvqqktlin
    pikidkpiftiqefdfkirqylmqtykiydpnspyikgqleiaingnkhesfnlydatss
    strsdifkkykdnktinmkdfshfdiylwtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ty0C (C:)
    senikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyittk
    ftknqkvnifglpyiftrydvyyiyggvtpsvnsnsenskivgnllidgvqqktlinpik
    idkpiftiqefdfkirqylmqtykiydpnspyikgqleiaingnkhesfnlydatssstr
    sdifkkykdnktinmkdfshfdiylwtk