PDB entry 1txz

View 1txz on RCSB PDB site
Description: Crystal structure of yeast ymx7, an ADP-ribose-1''-monophosphatase, complexed with ADP-ribose
Class: structural genomics, unknown function
Keywords: Structural Genomics, Dimer, Two domain organization, ADP-Ribose complex, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, unknown function
Deposited on 2004-07-06, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 32.1 kDa protein in ADH3-RCA1 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YMR087W, YM9582.12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1txza_
  • Heterogens: SO4, NA, APR, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txzA (A:)
    mtgslnrhsllngvkkmriilcdtnevvtnlwqesiphayiqndkylcihhghlqslmds
    mrkgdaihhghsyaivspgnsygylgggfdkalynyfggkpfetwfrnqlggryhtvgsa
    tvvdlqrcleektiecrdgiryiihvptvvapsapifnpqnplktgfepvfnamwnalmh
    spkdidgliipglctgyagvppiiscksmafalrlymagdhiskelknvlimyylqypfe
    pffpesckiecqklgidiemlksfnvekdaielliprriltldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txzA (A:)
    kmriilcdtnevvtnlwqesipkylcihhghlqslmdsmrkgdahsyaivspgnsygylg
    ggfdkalynyfggkpfetwfrnqlggryhtvgsatvvdlqrcleecrdgiryiihvptvv
    apsapifnpqnplktgfepvfnamwnalmhspkdidgliipglctgyagvppiiscksma
    falrlymagdhiskelknvlimyylqypfepffpesckiecqklgidiemlksfnvekda
    ielliprri