PDB entry 1txy

View 1txy on RCSB PDB site
Description: E. coli PriB
Class: DNA binding protein
Keywords: OB fold, dimer
Deposited on 2004-07-06, released 2004-11-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.26
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: primosomal replication protein n
    Species: Escherichia coli
    Gene: PRIB, B4201
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07013 (1-End)
      • initiating methionine (0)
      • modified residue (49)
      • modified residue (89)
    Domains in SCOP 1.73: d1txya_
  • Chain 'B':
    Compound: primosomal replication protein n
    Species: Escherichia coli
    Gene: PRIB, B4201
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07013 (1-End)
      • initiating methionine (0)
      • modified residue (49)
      • modified residue (89)
    Domains in SCOP 1.73: d1txyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txyA (A:)
    mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenq
    aithsitvgsritvqgfischkaknglskmvlhaeqielidsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txyA (A:)
    mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenq
    aithsitvgsritvqgfisckmvlhaeqieli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1txyB (B:)
    mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenq
    aithsitvgsritvqgfischkaknglskmvlhaeqielidsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txyB (B:)
    mtnrlvlsgtvcraplrkphcqfvlehrsvqeeagfhrqawcqmpvivsghenqaithsi
    tvgsritvqgfischmvlhaeqie