PDB entry 1txy

View 1txy on RCSB PDB site
Description: E. coli PriB
Deposited on 2004-07-06, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.26
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1txya_
  • Chain 'B':
    Domains in SCOP 1.71: d1txyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txyA (A:)
    mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenq
    aithsitvgsritvqgfischkaknglskmvlhaeqielidsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txyA (A:)
    mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenq
    aithsitvgsritvqgfisckmvlhaeqieli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1txyB (B:)
    mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenq
    aithsitvgsritvqgfischkaknglskmvlhaeqielidsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txyB (B:)
    mtnrlvlsgtvcraplrkphcqfvlehrsvqeeagfhrqawcqmpvivsghenqaithsi
    tvgsritvqgfischmvlhaeqie