PDB entry 1txu

View 1txu on RCSB PDB site
Description: crystal structure of the vps9 domain of rabex-5
Deposited on 2004-07-06, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.227
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1txua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txuA (A:)
    mghhhhhhgssietdrvskefieflktfhktgqeiykqtklflegmhykrdlsieeqsec
    aqdfyhnvaermqtrgkvppervekimdqiekyimtrlykyvfcpettddekkdlaiqkr
    iralrwvtpqmlcvpvnedipevsdmvvkaitdiiemdskrvprdklacitkcskhifna
    ikitknepasaddflptliyivlkgnpprlqsniqyitrfcnpsrlmtgedgyyftnlcc
    avafiekldaqslnlsqedfdrymsgqtsprkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txuA (A:)
    etdrvskefieflktfhktgqeiykqtklflegmhykrdlsieeqsecaqdfyhnvaerm
    qtrgkvppervekimdqiekyimtrlykyvfcpettddekkdlaiqkriralrwvtpqml
    cvpvnedipevsdmvvkaitdiiemdskrvprdklacitkcskhifnaikitknepasad
    dflptliyivlkgnpprlqsniqyitrfcnpsrlmtgedgyyftnlccavafiekldaqs
    lnlsqedfdrymsg