PDB entry 1txu

View 1txu on RCSB PDB site
Description: Crystal Structure of the Vps9 Domain of Rabex-5
Class: protein transport
Keywords: vps9 domain, rab5 guanine-nucleotide exchange factor, gef, protein transport
Deposited on 2004-07-06, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.227
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rab5 GDP/GTP exchange factor
    Species: Homo sapiens [TaxId:9606]
    Gene: RABGEF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ41
      • modified residue (45)
      • modified residue (71)
      • modified residue (86)
      • modified residue (94)
      • modified residue (130)
      • modified residue (145)
      • modified residue (156)
      • modified residue (226)
      • modified residue (263)
    Domains in SCOPe 2.07: d1txua_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txuA (A:)
    mghhhhhhgssietdrvskefieflktfhktgqeiykqtklflegmhykrdlsieeqsec
    aqdfyhnvaermqtrgkvppervekimdqiekyimtrlykyvfcpettddekkdlaiqkr
    iralrwvtpqmlcvpvnedipevsdmvvkaitdiiemdskrvprdklacitkcskhifna
    ikitknepasaddflptliyivlkgnpprlqsniqyitrfcnpsrlmtgedgyyftnlcc
    avafiekldaqslnlsqedfdrymsgqtsprkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txuA (A:)
    etdrvskefieflktfhktgqeiykqtklflegmhykrdlsieeqsecaqdfyhnvaerm
    qtrgkvppervekimdqiekyimtrlykyvfcpettddekkdlaiqkriralrwvtpqml
    cvpvnedipevsdmvvkaitdiiemdskrvprdklacitkcskhifnaikitknepasad
    dflptliyivlkgnpprlqsniqyitrfcnpsrlmtgedgyyftnlccavafiekldaqs
    lnlsqedfdrymsg