PDB entry 1txt

View 1txt on RCSB PDB site
Description: Staphylococcus aureus 3-hydroxy-3-methylglutaryl-CoA synthase
Deposited on 2004-07-06, released 2004-08-31
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txtA (A:)
    mtigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeaayaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txtA (A:)
    tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeaayaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1txtB (B:)
    mtigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeaayaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txtB (B:)
    tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeaayaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1txtC (C:)
    mtigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeaayaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txtC (C:)
    tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeaayaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1txtD (D:)
    mtigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeaayaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txtD (D:)
    tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeaayaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpe