PDB entry 1txt

View 1txt on RCSB PDB site
Description: Staphylococcus aureus 3-hydroxy-3-methylglutaryl-CoA synthase
Class: lyase
Keywords: HMG-CoA synthase; HMGS, coenzyme A; thiolase fold; condensing enzyme; cholesterol biosynthesis, LYASE
Deposited on 2004-07-06, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxy-3-methylglutaryl-CoA synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FD87 (Start-387)
      • modified residue (110)
      • conflict (319)
    Domains in SCOPe 2.07: d1txta1, d1txta2
  • Chain 'B':
    Compound: 3-hydroxy-3-methylglutaryl-CoA synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FD87 (Start-387)
      • modified residue (110)
      • conflict (319)
    Domains in SCOPe 2.07: d1txtb1, d1txtb2
  • Chain 'C':
    Compound: 3-hydroxy-3-methylglutaryl-CoA synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FD87 (Start-387)
      • modified residue (110)
      • conflict (319)
    Domains in SCOPe 2.07: d1txtc1, d1txtc2
  • Chain 'D':
    Compound: 3-hydroxy-3-methylglutaryl-CoA synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FD87 (Start-387)
      • modified residue (110)
      • conflict (319)
    Domains in SCOPe 2.07: d1txtd1, d1txtd2
  • Heterogens: CAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txtA (A:)
    mtigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txtA (A:)
    tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1txtB (B:)
    mtigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txtB (B:)
    tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1txtC (C:)
    mtigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txtC (C:)
    tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1txtD (D:)
    mtigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txtD (D:)
    tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpe