PDB entry 1txq

View 1txq on RCSB PDB site
Description: Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of p150Glued
Class: structural protein/protein binding
Keywords: protein complex
Deposited on 2004-07-06, released 2005-09-13
The last revision prior to the SCOP 1.73 freeze date was dated 2005-09-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynactin 1
    Species: HOMO SAPIENS
    Gene: p150Glued
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1txqa1
  • Chain 'B':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: HOMO SAPIENS
    Gene: EB1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1txqb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txqA (A:)
    gsrmsaeasarplrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvq
    grkyftcdeghgifvrqsqiqvfedgadttspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txqA (A:)
    rplrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdeg
    hgifvrqsqiqvfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1txqB (B:)
    npgvgngddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqri
    vdilyatdegfvipdeggpqeeqeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txqB (B:)
    eaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatde
    gfvi