PDB entry 1txn

View 1txn on RCSB PDB site
Description: Crystal structure of coproporphyrinogen III oxidase
Class: oxidoreductase
Keywords: Structural genomics, Dimer, Novel fold, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, oxidoreductase
Deposited on 2004-07-05, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.211
AEROSPACI score: -1.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coproporphyrinogen III oxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HEM13, YDR044W, YD5112.02
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11353
      • modified residue (15)
      • modified residue (55)
      • modified residue (85)
      • modified residue (117)
      • modified residue (226)
      • modified residue (248)
    Domains in SCOPe 2.07: d1txna_
  • Chain 'B':
    Compound: Coproporphyrinogen III oxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HEM13, YDR044W, YD5112.02
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11353
      • modified residue (15)
      • modified residue (55)
      • modified residue (85)
      • modified residue (117)
      • modified residue (226)
      • modified residue (248)
    Domains in SCOPe 2.07: d1txnb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txnA (A:)
    mpapqdprnlpirqqmealirrkqaeitqglesidtvkfhadtwtrgndggggtsmviqd
    gttfekggvnvsvvygqlspaavsamkadhknlrlpedpktglpvtdgvkffacglsmvi
    hpvnphaptthlnyryfetwnqdgtpqtwwfgggadltpsylyeedgqlfhqlhkdaldk
    hdtalyprfkkwcdeyfyithrketrgiggiffddyderdpqeilkmvedcfdaflpsyl
    tivkrrkdmpytkeeqqwqairrgryvefnliydrgtqfglrtpgsrvesilmslpehas
    wlynhhpapgsreakllevttkprewvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txnA (A:)
    papqdprnlpirqqmealirrkqaeitqglesidtvkfhadtwtrgndggggtsmviqdg
    ttfekggvnvsvvygqlspaavsamkadhknlrlpdgvkffacglsmvihpvnphaptth
    lnyryfetwnqdgtpqtwwfgggadltpsylyeedgqlfhqlhkdaldkhdtalyprfkk
    wcdeyfyithrketrgiggiffddyderdpqeilkmvedcfdaflpsyltivkrrkdmpy
    tkeeqqwqairrgryvefn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1txnB (B:)
    mpapqdprnlpirqqmealirrkqaeitqglesidtvkfhadtwtrgndggggtsmviqd
    gttfekggvnvsvvygqlspaavsamkadhknlrlpedpktglpvtdgvkffacglsmvi
    hpvnphaptthlnyryfetwnqdgtpqtwwfgggadltpsylyeedgqlfhqlhkdaldk
    hdtalyprfkkwcdeyfyithrketrgiggiffddyderdpqeilkmvedcfdaflpsyl
    tivkrrkdmpytkeeqqwqairrgryvefnliydrgtqfglrtpgsrvesilmslpehas
    wlynhhpapgsreakllevttkprewvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txnB (B:)
    papqdprnlpirqqmealirrkqaeitqglesidtvkfhadtwtrgndggggtsmviqdg
    ttfekggvnvsvvygqlspaavsamkadhknlrlpdgvkffacglsmvihpvnphaptth
    lnyryfetwnqdgtpqtwwfgggadltpsylyeedgqlfhqlhkdaldkhdtalyprfkk
    wcdeyfyithrrgiggiffddyderdpqeilkmvedcfdaflpsyltivkrrkdmpytke
    eqqwqairrgryvefn