PDB entry 1txm

View 1txm on RCSB PDB site
Description: scorpion toxin (maurotoxin) from scorpio maurus, nmr, 35 structures
Class: neurotoxin
Keywords: neurotoxin, toxin, scorpion, potassium channel blocker, alpha beta scorpion toxin fold
Deposited on 1996-11-19, released 1997-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maurotoxin
    Species: Scorpio maurus [TaxId:53956]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1txma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txmA (A:)
    vsctgskdcyapcrkqtgcpnakcinksckcygc