PDB entry 1txl

View 1txl on RCSB PDB site
Description: Crystal structure of metal-binding protein yodA from E. coli, Pfam DUF149
Class: structural genomics, unknown function
Keywords: yodA, E.coli, structural genomics, new fold, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, unknown function
Deposited on 2004-07-05, released 2004-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.228
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metal-binding protein yodA
    Species: Escherichia coli [TaxId:562]
    Gene: YODA, B1973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1txla_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txlA (A:)
    airlyklavalgvfivsapafshghhshgkplteveqkaangvfddanvqnrtlsdwdgv
    wqsvypllqsgkldpvfqkkadadktktfaeikdyyhkgyatdiemigiedgivefhrnn
    ettsckydydgykiltyksgkkgvrylfeckdpeskapkyiqfsdhiiaprksshfhifm
    gndsqqsllnemenwptyypyqlsseevveemmsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txlA (A:)
    hgkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktk
    tfaeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvryl
    feckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlssee
    vveemmsh