PDB entry 1txj

View 1txj on RCSB PDB site
Description: Crystal structure of translationally controlled tumour-associated protein (TCTP) from Plasmodium knowlesi
Class: structural genomics, unknown function
Keywords: Structural Genomics Consortium, SGC, guanine nucleotide-free chaperones, guanine nucleotide exchange factor, beta-sandwich, helix-turn-helix, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2004-07-05, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translationally controlled tumour-associated protein (TCTP) from Plasmodium knowlesi, PKN_PFE0545c
    Species: Plasmodium knowlesi [TaxId:5850]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1txja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txjA (A:)
    mkvykdvftndevcsdsynqedpfgiadfreiafevksnkrikgnddygiadnseeavdg
    mgadveqvidivdsfqltstslskkeysvyiknymqkilkyleekkpdrvdvfktkaqpl
    ikhiltnfddfefymgesldmdagltysyykgeevtprfvyisdglyeekf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txjA (A:)
    mkvykdvftndevcsdsynqedpfgiadfreiafevksnkrikgngmgadveqvidivds
    fqltstslskkeysvyiknymqkilkyleekkpdrvdvfktkaqplikhiltnfddfefy
    mgesldmdagltysyykgeevtprfvyisdglyeekf