PDB entry 1txg

View 1txg on RCSB PDB site
Description: Structure of glycerol-3-phosphate dehydrogenase from Archaeoglobus fulgidus
Deposited on 2004-07-05, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.151
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txgA (A:)
    mivsilgagamgsalsvplvdngnevriwgtefdteilksisagrehprlgvklngveif
    wpeqlekclenaevvllgvstdgvlpvmsrilpylkdqyivliskglidfdnsvltvpea
    vwrlkhdlrertvaitgpaiarevakrmpttvvfsspsessankmkeifeteyfgvevtt
    diigteitsalknvysiaiawirgyesrknvemsnakgviatrainemaelieilggdre
    tafglsgfgdliatfrggrngmlgellgkglsideameelerrgvgvvegyktaekayrl
    sskinadtklldsiyrvlyeglkveevlfelatfk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txgB (B:)
    mivsilgagamgsalsvplvdngnevriwgtefdteilksisagrehprlgvklngveif
    wpeqlekclenaevvllgvstdgvlpvmsrilpylkdqyivliskglidfdnsvltvpea
    vwrlkhdlrertvaitgpaiarevakrmpttvvfsspsessankmkeifeteyfgvevtt
    diigteitsalknvysiaiawirgyesrknvemsnakgviatrainemaelieilggdre
    tafglsgfgdliatfrggrngmlgellgkglsideameelerrgvgvvegyktaekayrl
    sskinadtklldsiyrvlyeglkveevlfelatfk