PDB entry 1txg

View 1txg on RCSB PDB site
Description: Structure of glycerol-3-phosphate dehydrogenase from Archaeoglobus fulgidus
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2004-07-05, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.151
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol-3-phosphate dehydrogenase [NAD(P)+]
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1txga1, d1txga2
  • Chain 'B':
    Compound: glycerol-3-phosphate dehydrogenase [NAD(P)+]
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1txgb1, d1txgb2
  • Heterogens: SO4, NH4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txgA (A:)
    mivsilgagamgsalsvplvdngnevriwgtefdteilksisagrehprlgvklngveif
    wpeqlekclenaevvllgvstdgvlpvmsrilpylkdqyivliskglidfdnsvltvpea
    vwrlkhdlrertvaitgpaiarevakrmpttvvfsspsessankmkeifeteyfgvevtt
    diigteitsalknvysiaiawirgyesrknvemsnakgviatrainemaelieilggdre
    tafglsgfgdliatfrggrngmlgellgkglsideameelerrgvgvvegyktaekayrl
    sskinadtklldsiyrvlyeglkveevlfelatfk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txgB (B:)
    mivsilgagamgsalsvplvdngnevriwgtefdteilksisagrehprlgvklngveif
    wpeqlekclenaevvllgvstdgvlpvmsrilpylkdqyivliskglidfdnsvltvpea
    vwrlkhdlrertvaitgpaiarevakrmpttvvfsspsessankmkeifeteyfgvevtt
    diigteitsalknvysiaiawirgyesrknvemsnakgviatrainemaelieilggdre
    tafglsgfgdliatfrggrngmlgellgkglsideameelerrgvgvvegyktaekayrl
    sskinadtklldsiyrvlyeglkveevlfelatfk