PDB entry 1txe

View 1txe on RCSB PDB site
Description: Solution structure of the active-centre mutant Ile14Ala of the histidine-containing phosphocarrier protein (HPr) from Staphylococcus carnosus
Class: transport protein
Keywords: open-faced beta-sandwich, Structural Proteomics in Europe, SPINE, Structural Genomics, TRANSPORT PROTEIN
Deposited on 2004-07-04, released 2005-03-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphocarrier protein HPr
  Species: Staphylococcus carnosus [TaxId:1281]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23534 (0-87)
    • engineered (13)
  Domains in SCOPe 2.04: d1txea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1txeA (A:)
  meqqsytiidetgaharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdae
  itiyadgsdeadaiqaitdvlskeglte