PDB entry 1txd

View 1txd on RCSB PDB site
Description: crystal structure of the dh/ph domains of leukemia-associated rhogef
Deposited on 2004-07-03, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.237
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txdA (A:)
    gsppnwqqlvsrevllglkpceikrqevinelfyterahvrtlkvldqvfyqrvsregil
    spselrkifsnledilqlhiglneqmkavrkrnetsvidqigedlltwfsgpgeeklkha
    aatfcsnqpfalemiksrqkkdsrfqtfvqdaesnplcrrlqlkdiiptqmqrltkypll
    ldniakytewpterekvkkaadhcrqilnfvnqavkeaenkqrledyqrrldtsslklse
    ypnveelrnldltkrkmihegplvwkvnrdktidlytllledilvllqkqddrlvlrchs
    kilastadskhtfspviklstvlvrqvatdnkalfvismsdngaqiyelvaqtvsektvw
    qdlicrmaasvkeqsvdgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txdA (A:)
    ppnwqqlvsrevllglkpceikrqevinelfyterahvrtlkvldqvfyqrvsregilsp
    selrkifsnledilqlhiglneqmkavrkrnetsvidqigedlltwfsgpgeeklkhaaa
    tfcsnqpfalemiksrqkkdsrfqtfvqdaesnplcrrlqlkdiiptqmqrltkypllld
    niakytewpterekvkkaadhcrqilnfvnqavkeaenkqrledyqrrldtsslveelrn
    ldltkrkmihegplvwkvnrdktidlytllledilvllqkqddrlvlrctfspviklstv
    lvrqvatnkalfvismsdngaqiyelvaqtvsektvwqdlicrmaasvkeqs