PDB entry 1txd

View 1txd on RCSB PDB site
Description: Crystal Structure of the DH/PH domains of Leukemia-associated RhoGEF
Class: signaling protein
Keywords: helical bundle (DH), beta sandwich (PH), SIGNALING PROTEIN
Deposited on 2004-07-03, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.237
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 12
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF12, LARG, KIAA0382
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZN5 (Start-374)
      • engineered (209)
    Domains in SCOPe 2.07: d1txda1, d1txda2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txdA (A:)
    gsppnwqqlvsrevllglkpceikrqevinelfyterahvrtlkvldqvfyqrvsregil
    spselrkifsnledilqlhiglneqmkavrkrnetsvidqigedlltwfsgpgeeklkha
    aatfcsnqpfalemiksrqkkdsrfqtfvqdaesnplcrrlqlkdiiptqmqrltkypll
    ldniakytewpterekvkkaadhcrqilnfvnqavkeaenkqrledyqrrldtsslklse
    ypnveelrnldltkrkmihegplvwkvnrdktidlytllledilvllqkqddrlvlrchs
    kilastadskhtfspviklstvlvrqvatdnkalfvismsdngaqiyelvaqtvsektvw
    qdlicrmaasvkeqsvdgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txdA (A:)
    ppnwqqlvsrevllglkpceikrqevinelfyterahvrtlkvldqvfyqrvsregilsp
    selrkifsnledilqlhiglneqmkavrkrnetsvidqigedlltwfsgpgeeklkhaaa
    tfcsnqpfalemiksrqkkdsrfqtfvqdaesnplcrrlqlkdiiptqmqrltkypllld
    niakytewpterekvkkaadhcrqilnfvnqavkeaenkqrledyqrrldtsslveelrn
    ldltkrkmihegplvwkvnrdktidlytllledilvllqkqddrlvlrctfspviklstv
    lvrqvatnkalfvismsdngaqiyelvaqtvsektvwqdlicrmaasvkeqs