PDB entry 1txc

View 1txc on RCSB PDB site
Description: Complex crystal structure of SPE16 with ANS
Class: plant protein
Keywords: seven antiparallel beta-sheet, PLANT PROTEIN
Deposited on 2004-07-02, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pathogenesis-related class 10 protein SPE-16
    Species: Pachyrhizus erosus [TaxId:109171]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6T6J0 (0-146)
      • cloning artifact (147-156)
    Domains in SCOPe 2.07: d1txca2, d1txca3
  • Chain 'B':
    Compound: pathogenesis-related class 10 protein SPE-16
    Species: Pachyrhizus erosus [TaxId:109171]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6T6J0 (0-146)
      • cloning artifact (147-156)
    Domains in SCOPe 2.07: d1txcb2, d1txcb3
  • Heterogens: 2AN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txcA (A:)
    gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg
    dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh
    tkgdaplsdavrddalakgagffkaiegyvlanpaey
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txcB (B:)
    gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg
    dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh
    tkgdaplsdavrddalakgagffkaiegyvlanpaey