PDB entry 1txa

View 1txa on RCSB PDB site
Description: solution nmr structure of toxin b, a long neurotoxin from the venom of the king cobra, minimized average structure
Class: neurotoxin
Keywords: venom, neurotoxin, multigene family, toxin b
Deposited on 1996-07-20, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxin b
    Species: OPHIOPHAGUS HANNAH [TaxId:8665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1txaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txaA (A:)
    tkcyvtpdatsqtcpdgqdicytktwcdgfcssrgkridlgcaatcpkvkpgvdikccst
    dncnpfptwkrkh