PDB entry 1tx9

View 1tx9 on RCSB PDB site
Description: gpd prior to capsid assembly
Class: structural protein
Keywords: scaffolding protein, phiX174, assembly, conformational switching, STRUCTURAL PROTEIN
Deposited on 2004-06-24, released 2005-04-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.31 Å
R-factor: 0.271
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Scaffolding protein D
    Species: Enterobacteria phage phiX174 sensu lato [TaxId:10847]
    Gene: D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tx9a1
  • Chain 'B':
    Compound: Scaffolding protein D
    Species: Enterobacteria phage phiX174 sensu lato [TaxId:10847]
    Gene: D
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1tx9A (A:)
sqvteqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvyg
tldfvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelf
aftlrvragntdvltdaeenvrqklraegvm

    Sequence, based on observed residues (ATOM records): (download) 
    >1tx9A (A:)
vteqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtl
dfvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaf
tlrvragntdvltdaeenvrq

  • Chain 'B':
    No sequence available.