PDB entry 1tx3

View 1tx3 on RCSB PDB site
Description: hincii bound to cognate DNA
Class: hydrolase/DNA
Keywords: restriction endonuclease, blunt cutting, protein-DNA, indirect readout, DNA bending, hydrolase/DNA complex
Deposited on 2004-07-01, released 2005-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II restriction enzyme HindII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HINDIIR, HI0512
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44413 (0-256)
      • conflict (65)
    Domains in SCOPe 2.06: d1tx3a_
  • Chain 'B':
    Compound: Type II restriction enzyme HindII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HINDIIR, HI0512
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44413 (0-End)
      • conflict (65)
    Domains in SCOPe 2.06: d1tx3b_
  • Chain 'C':
    Compound: Type II restriction enzyme HindII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HINDIIR, HI0512
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44413 (0-End)
      • conflict (65)
    Domains in SCOPe 2.06: d1tx3c_
  • Chain 'D':
    Compound: Type II restriction enzyme HindII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HINDIIR, HI0512
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44413 (0-End)
      • conflict (65)
    Domains in SCOPe 2.06: d1tx3d_
  • Chain 'E':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*g)-3'
  • Chain 'F':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*g)-3'
  • Chain 'G':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*g)-3'
  • Chain 'H':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*g)-3'
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tx3A (A:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tx3A (A:)
    sfikpiyqdinsiligqkvkrpaagepfeklvykflkenlsdltfkqyeylndlfmknpa
    iighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvk
    trnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfae
    lfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkf
    vkpfkkyil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tx3B (B:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tx3B (B:)
    sfikpiyqdinsiligqkvkrpktlsghaagepfeklvykflkenlsdltfkqyeylndl
    fmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfy
    elldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcv
    stsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqrai
    smidkfvkpfkkyi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tx3C (C:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tx3C (C:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkqf
    yelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvc
    vstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqra
    ismidkfvkpfkkyi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tx3D (D:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tx3D (D:)
    sfikpiyqdinsiligqkvkrepfeklvykflkenlsdltfkqyeylndlfmknpaiigh
    earyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvktrni
    sksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfaelfks
    epselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfvkpf
    kkyi
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.