PDB entry 1tx2

View 1tx2 on RCSB PDB site
Description: Dihydropteroate Synthetase, With Bound Inhibitor MANIC, From Bacillus anthracis
Class: Transferase
Keywords: anthracis, folate biosynthesis, dihydropteroate, pterine, MANIC, Transferase
Deposited on 2004-07-01, released 2004-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.184
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DHPS, Dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: FolP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tx2a_
  • Chain 'B':
    Compound: DHPS, Dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: FolP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tx2b_
  • Heterogens: SO4, 680, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tx2A (A:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tx2A (A:)
    kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
    iggesfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwga
    kaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildp
    gigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclg
    iekgcefvrvhdvkemsrmakmmdamigk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tx2B (B:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tx2B (B:)
    kwdydlrcgeytlnlnektlimgilnvtpsdggsynevdaavrhakemrdegahiidigg
    vsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiae
    vaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktp
    eqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefv
    rvhdvkemsrmakmmdamigk