PDB entry 1twy

View 1twy on RCSB PDB site
Description: crystal structure of an abc-type phosphate transport receptor from vibrio cholerae
Deposited on 2004-07-01, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.194
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1twya_
  • Chain 'B':
    Domains in SCOP 1.71: d1twyb_
  • Chain 'C':
    Domains in SCOP 1.71: d1twyc_
  • Chain 'D':
    Domains in SCOP 1.71: d1twyd_
  • Chain 'E':
    Domains in SCOP 1.71: d1twye_
  • Chain 'F':
    Domains in SCOP 1.71: d1twyf_
  • Chain 'G':
    Domains in SCOP 1.71: d1twyg_
  • Chain 'H':
    Domains in SCOP 1.71: d1twyh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1twyA (A:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyA (A:)
    seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
    eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
    treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig
    svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl
    iveygyimp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1twyB (B:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyB (B:)
    eitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylte
    seaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavvt
    reassgtrysfeslmgltkrevsdvaptalvvnsnsmmktlvnhntqavgfisigsvdks
    vkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkliveyg
    yimp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1twyC (C:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyC (C:)
    seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
    eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
    treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig
    svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl
    iveygyimp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1twyD (D:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyD (D:)
    seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
    eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
    treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig
    svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl
    iveygyimp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1twyE (E:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyE (E:)
    eitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylte
    seaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavvt
    reassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisigs
    vdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkli
    veygyimp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1twyF (F:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyF (F:)
    seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
    eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
    treassgtrysfeslmgltktdrevsdvaptalvvnsnsmmktlvnhntqavgfisigsv
    dksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkliv
    eygyimp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1twyG (G:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyG (G:)
    seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
    eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
    treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig
    svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl
    iveygyimp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1twyH (H:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyH (H:)
    seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
    eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
    treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig
    svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl
    iveygyimp