PDB entry 1twy

View 1twy on RCSB PDB site
Description: Crystal structure of an ABC-type phosphate transport receptor from Vibrio cholerae
Class: structural genomics, unknown function
Keywords: ABC transporter, NYSGXRC target, Structural Genomics, Protein Structure Initiative, PSI, New York SGX Research Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-07-01, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.194
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter, periplasmic substrate-binding protein
    Species: Vibrio cholerae [TaxId:243277]
    Database cross-references and differences (RAF-indexed):
    • GB NP_233193
      • modified residue (41)
      • modified residue (80)
      • modified residue (162)
      • modified residue (188-189)
      • modified residue (274)
    Domains in SCOPe 2.07: d1twya_
  • Chain 'B':
    Compound: ABC transporter, periplasmic substrate-binding protein
    Species: Vibrio cholerae [TaxId:243277]
    Database cross-references and differences (RAF-indexed):
    • GB NP_233193
      • modified residue (41)
      • modified residue (80)
      • modified residue (162)
      • modified residue (188-189)
      • modified residue (274)
    Domains in SCOPe 2.07: d1twyb_
  • Chain 'C':
    Compound: ABC transporter, periplasmic substrate-binding protein
    Species: Vibrio cholerae [TaxId:243277]
    Database cross-references and differences (RAF-indexed):
    • GB NP_233193
      • modified residue (41)
      • modified residue (80)
      • modified residue (162)
      • modified residue (188-189)
      • modified residue (274)
    Domains in SCOPe 2.07: d1twyc_
  • Chain 'D':
    Compound: ABC transporter, periplasmic substrate-binding protein
    Species: Vibrio cholerae [TaxId:243277]
    Database cross-references and differences (RAF-indexed):
    • GB NP_233193
      • modified residue (41)
      • modified residue (80)
      • modified residue (162)
      • modified residue (188-189)
      • modified residue (274)
    Domains in SCOPe 2.07: d1twyd_
  • Chain 'E':
    Compound: ABC transporter, periplasmic substrate-binding protein
    Species: Vibrio cholerae [TaxId:243277]
    Database cross-references and differences (RAF-indexed):
    • GB NP_233193
      • modified residue (41)
      • modified residue (80)
      • modified residue (162)
      • modified residue (188-189)
      • modified residue (274)
    Domains in SCOPe 2.07: d1twye_
  • Chain 'F':
    Compound: ABC transporter, periplasmic substrate-binding protein
    Species: Vibrio cholerae [TaxId:243277]
    Database cross-references and differences (RAF-indexed):
    • GB NP_233193
      • modified residue (41)
      • modified residue (80)
      • modified residue (162)
      • modified residue (188-189)
      • modified residue (274)
    Domains in SCOPe 2.07: d1twyf_
  • Chain 'G':
    Compound: ABC transporter, periplasmic substrate-binding protein
    Species: Vibrio cholerae [TaxId:243277]
    Database cross-references and differences (RAF-indexed):
    • GB NP_233193
      • modified residue (41)
      • modified residue (80)
      • modified residue (162)
      • modified residue (188-189)
      • modified residue (274)
    Domains in SCOPe 2.07: d1twyg_
  • Chain 'H':
    Compound: ABC transporter, periplasmic substrate-binding protein
    Species: Vibrio cholerae [TaxId:243277]
    Database cross-references and differences (RAF-indexed):
    • GB NP_233193
      • modified residue (41)
      • modified residue (80)
      • modified residue (162)
      • modified residue (188-189)
      • modified residue (274)
    Domains in SCOPe 2.07: d1twyh_
  • Heterogens: PO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1twyA (A:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyA (A:)
    seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
    eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
    treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig
    svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl
    iveygyimp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1twyB (B:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyB (B:)
    eitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylte
    seaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavvt
    reassgtrysfeslmgltkrevsdvaptalvvnsnsmmktlvnhntqavgfisigsvdks
    vkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkliveyg
    yimp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1twyC (C:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyC (C:)
    seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
    eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
    treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig
    svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl
    iveygyimp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1twyD (D:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyD (D:)
    seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
    eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
    treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig
    svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl
    iveygyimp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1twyE (E:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyE (E:)
    eitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylte
    seaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavvt
    reassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisigs
    vdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkli
    veygyimp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1twyF (F:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyF (F:)
    seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
    eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
    treassgtrysfeslmgltktdrevsdvaptalvvnsnsmmktlvnhntqavgfisigsv
    dksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkliv
    eygyimp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1twyG (G:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyG (G:)
    seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
    eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
    treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig
    svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl
    iveygyimp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1twyH (H:)
    mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvav
    qgvgstagisllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltr
    eqlygiykgqitnwkqvggndqkiavvtreassgtrysfeslmgltktvkdrevsdvapt
    alvvnsnsmmktlvnhntqavgfisigsvdksvkaiqfekadptsdniakhtyqlsrpfl
    ilhysdnadeqtkefiaflksesakkliveygyimpsdveeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twyH (H:)
    seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
    eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
    treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig
    svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl
    iveygyimp