PDB entry 1twx

View 1twx on RCSB PDB site
Description: crystal structure of the thrombin mutant d221a/d222k
Deposited on 2004-07-01, released 2005-04-19
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-258)
      • engineered (187)
      • engineered (190)
  • Chain 'C':
    Compound: hirudin
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1twxA (A:)
    adcglrplfekksledkterellesyid
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1twxB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcarkgkygfy
    thvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records):
    >1twxB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketgqpsvlqvvnlpiverpvckdstriritdnmfc
    agykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcarkgkygfythvfrlk
    kwiqkvidqfge
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1twxC (C:)
    dfeeipgeyl