PDB entry 1tww

View 1tww on RCSB PDB site
Description: Dihydropteroate Synthetase, With Bound Substrate Analogue PtPP, From Bacillus anthracis
Class: Transferase
Keywords: anthracis, folate biosynthesis, dihydropteroate, pterine, Transferase
Deposited on 2004-07-01, released 2004-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DHPS, Dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: FolP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1twwa_
  • Chain 'B':
    Compound: DHPS, Dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: FolP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1twwb_
  • Heterogens: SO4, HH2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1twwA (A:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twwA (A:)
    kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
    iggesvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakae
    pkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgig
    faktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiek
    gcefvrvhdvkemsrmakmmdamigk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1twwB (B:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twwB (B:)
    kwdydlrcgeytlnlnektlimgilnvtpggsynevdaavrhakemrdegahiidiggev
    sveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiaev
    aahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktpe
    qnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefvr
    vhdvkemsrmakmmdamigk