PDB entry 1tww

View 1tww on RCSB PDB site
Description: dihydropteroate synthetase, with bound substrate analogue ptpp, from bacillus anthracis
Deposited on 2004-07-01, released 2004-09-14
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1twwa_
  • Chain 'B':
    Domains in SCOP 1.69: d1twwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1twwA (A:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twwA (A:)
    kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
    iggesvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakae
    pkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgig
    faktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiek
    gcefvrvhdvkemsrmakmmdamigk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1twwB (B:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twwB (B:)
    kwdydlrcgeytlnlnektlimgilnvtpggsynevdaavrhakemrdegahiidiggev
    sveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiaev
    aahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktpe
    qnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefvr
    vhdvkemsrmakmmdamigk