PDB entry 1twu

View 1twu on RCSB PDB site
Description: 2.0 A Crystal Structure of a YycE Protein of Unknown Function from Bacillus subtilis, Putative Glyoxalase/Fosfomycin Resistance Protein
Class: structural genomics, unknown function
Keywords: Structural genomics, Protein structure initiative, MCSG, duplication of the alpha-beta sandwichs. Bacillus subtilis, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-07-01, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yycE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YYCE or BSU40430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1twua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1twuA (A:)
    mgkrfssfqaaqiriarptgqldeiirfyeeglclkrigefsqhngydgvmfglphadyh
    leftqyeggstapvphpdsllvfyvpnavelaaitsklkhmgyqevesenpywsnggvti
    edpdgwrivfmnskgisgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twuA (A:)
    krfssfqaaqiriarptgqldeiirfyeeglclkrigefsqhngydgvmfglphadyhle
    ftqyeggstapvphpdsllvfyvpnavelaaitsklkhmgyqevesenpywsnggvtied
    pdgwrivfmnskgisgk