PDB entry 1tws

View 1tws on RCSB PDB site
Description: Dihydropteroate Synthetase From Bacillus anthracis
Class: transferase
Keywords: anthracis, folate biosynthesis, dihydropteroate, pterine, TRANSFERASE
Deposited on 2004-07-01, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DHPS, Dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: FolP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1twsa_
  • Chain 'B':
    Compound: DHPS, Dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: FolP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1twsb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1twsA (A:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twsA (A:)
    kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
    iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
    iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
    ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
    vclgiekgcefvrvhdvkemsrmakmmdamigk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1twsB (B:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twsB (B:)
    kwdydlrcgeytlnlnektlimgilnsdggsynevdaavrhakemrdegahiidiggest
    rpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgaka
    epkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgi
    gfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgie
    kgcefvrvhdvkemsrmakmmdamigk