PDB entry 1twr

View 1twr on RCSB PDB site
Description: Crystal structures of ferrous and ferrous-NO forms of verdoheme in a complex with human heme oxygenase-1: catalytic implications for heme cleavage
Class: oxidoreductase
Keywords: heme oxygenase-1, heme degredation, OXIDOREDUCTASE
Deposited on 2004-07-01, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.241
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO1, HO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1twra_
  • Chain 'B':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO1, HO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1twrb_
  • Heterogens: VER, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1twrA (A:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twrA (A:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1twrB (B:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twrB (B:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth