PDB entry 1twq

View 1twq on RCSB PDB site
Description: Crystal structure of the C-terminal PGN-binding domain of human PGRP-Ialpha in complex with PGN analog muramyl tripeptide
Class: immune system, membrane protein
Keywords: crystal structure; complex; PGRP; PGRP-Ialpha; PGN analog, IMMUNE SYSTEM, MEMBRANE PROTEIN
Deposited on 2004-07-01, released 2004-12-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidoglycan recognition protein-I-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PGLYRP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1twqa_
  • Chain 'P':
    Compound: muramyl tripeptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TWQ (0-End)
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1twqA (A:)
vcpniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrn
fcdigyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqd
liqcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh

  • Chain 'P':
    No sequence available.