PDB entry 1two

View 1two on RCSB PDB site
Description: NMR structure of the pheromone binding protein from Antheraea polyphemus at acidic pH
Class: pheromone binding protein
Keywords: ApolPBP, PBP, pheromone binding protein, conformational transition, conformational switch
Deposited on 2004-07-01, released 2005-10-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pheromone-binding protein
  Species: Antheraea polyphemus [TaxId:7120]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20797 (0-141)
  Domains in SCOPe 2.05: d1twoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1twoA (A:)
  speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld
  vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk
  eihklnwvpnmdlvigevlaev