PDB entry 1twm

View 1twm on RCSB PDB site
Description: Interleukin-1 Beta Mutant F146Y
Class: immune system
Keywords: Hydrophobic cavity, water, solvation, hydrophobicity, IMMUNE SYSTEM
Deposited on 2004-07-01, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.175
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interleukin-1 beta
  Species: Homo sapiens [TaxId:9606]
  Gene: IL1B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01584 (0-152)
    • engineered (145)
  Domains in SCOPe 2.08: d1twma_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1twmA (A:)
  apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
  glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
  yistsqaenmpvflggtkggqditdytmqfvss