PDB entry 1twl

View 1twl on RCSB PDB site
Description: Inorganic pyrophosphatase from Pyrococcus furiosus Pfu-264096-001
Class: hydrolase
Keywords: inorganic pyrophosphatase, structural genomics, protein structure initiative, PSI, Southeast Collaboratory for Structural Genomics, SECSG, HYDROLASE
Deposited on 2004-07-01, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PPA, PF0257
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1twla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1twlA (A:)
    ahhhhhhgsnpfhdlepgpdvpevvyaiieipkgsrnkyeldkktgllkldrvlyspffy
    pvdygiiprtwyedddpfdimvimrepvypltiiearpiglfkmidsgdkdykvlavpve
    dpyfkdwkdiddvpkafldeiahffkrykelqgkeiivegwegaeaakreilraiemyke
    kfgkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twlA (A:)
    npfhdlepgpdvpevvyaiieipkgsrnkyeldkktgllkldrvlyspffypvdygiipr
    twyeddpfdimvimrepvypltiiearpiglfkmidsgdkdykvlavpvedpyfkdwkdi
    ddvpkafldeiahffkrykelqgkeiivegwegaeaakreilraiemykekf