PDB entry 1twe

View 1twe on RCSB PDB site
Description: interleukin 1 beta mutant f101y
Class: immune system
Keywords: Hydrophobic cavity, Hydrophobicity, water, IMMUNE SYSTEM
Deposited on 2004-06-30, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.184
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: IL1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01584 (0-152)
      • engineered (100)
    Domains in SCOPe 2.07: d1twea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tweA (A:)
    apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
    glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvynkieinnklefesaqfpnw
    yistsqaenmpvflggtkggqditdftmqfvss