PDB entry 1twd

View 1twd on RCSB PDB site
Description: Crystal Structure of the Putative Copper Homeostasis Protein (CutC) from Shigella flexneri, Northeast Structural Genomics Target SfR33
Class: metal binding protein
Keywords: TIM-like protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, METAL BINDING PROTEIN
Deposited on 2004-06-30, released 2004-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper homeostasis protein cutC
    Species: Shigella flexneri [TaxId:623]
    Gene: CUTC, CUTCM, B1874, SF1915, S2005
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67825 (Start-247)
      • modified residue (10)
      • modified residue (102)
      • modified residue (105)
      • modified residue (109)
      • modified residue (125)
      • modified residue (161)
      • modified residue (173)
      • modified residue (206)
      • modified residue (237)
    Domains in SCOPe 2.08: d1twda_
  • Chain 'B':
    Compound: Copper homeostasis protein cutC
    Species: Shigella flexneri [TaxId:623]
    Gene: CUTC, CUTCM, B1874, SF1915, S2005
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67825 (Start-247)
      • modified residue (10)
      • modified residue (102)
      • modified residue (105)
      • modified residue (109)
      • modified residue (125)
      • modified residue (161)
      • modified residue (173)
      • modified residue (206)
      • modified residue (237)
      • expression tag (248)
    Domains in SCOPe 2.08: d1twdb1, d1twdb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1twdA (A:)
    malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
    rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
    hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
    aenlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkg
    iierhqaklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twdA (A:)
    alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
    ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
    rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
    enlhhfldagvlevhssagawqaspmryrnysryivdgaavaemkgiierhqak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1twdB (B:)
    malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
    rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
    hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
    aenlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkg
    iierhqaklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twdB (B:)
    alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
    ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
    rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
    enlhhfldagvlevhssagawqaspmryreysryivdgaavaemkgiierhqakl