PDB entry 1tw8

View 1tw8 on RCSB PDB site
Description: HincII bound to Ca2+ and cognate DNA GTCGAC
Class: hydrolase/DNA
Keywords: restriction endonuclease, hydrolase-DNA COMPLEX
Deposited on 2004-06-30, released 2004-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.18
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hinc II endonuclease
    Species: Haemophilus influenzae [TaxId:727]
    Gene: Hinc II
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tw8a_
  • Chain 'B':
    Compound: Hinc II endonuclease
    Species: Haemophilus influenzae [TaxId:727]
    Gene: Hinc II
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tw8b_
  • Chain 'C':
    Compound: Hinc II endonuclease
    Species: Haemophilus influenzae [TaxId:727]
    Gene: Hinc II
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tw8c_
  • Chain 'D':
    Compound: Hinc II endonuclease
    Species: Haemophilus influenzae [TaxId:727]
    Gene: Hinc II
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tw8d_
  • Chain 'E':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tw8A (A:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tw8B (B:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw8B (B:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tw8C (C:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tw8D (D:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw8D (D:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkky
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.