PDB entry 1tw8

View 1tw8 on RCSB PDB site
Description: hincii bound to ca2+ and cognate dna gtcgac
Deposited on 2004-06-30, released 2004-08-10
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.18
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tw8a_
  • Chain 'B':
    Domains in SCOP 1.69: d1tw8b_
  • Chain 'C':
    Domains in SCOP 1.69: d1tw8c_
  • Chain 'D':
    Domains in SCOP 1.69: d1tw8d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tw8A (A:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tw8B (B:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw8B (B:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tw8C (C:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tw8D (D:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw8D (D:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkky